General Information

  • ID:  hor002099
  • Uniprot ID:  Q08279
  • Protein name:  Preptin
  • Gene name:  IGF2
  • Organism:  Cavia porcellus (Guinea pig)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  Expressed predominantly in fetal tissues and at lower levels in adult.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005178 integrin binding; GO:0005179 hormone activity; GO:0005515 protein binding; GO:0008083 growth factor activity
  • GO BP:  GO:0000122 negative regulation of transcription by RNA polymerase II; GO:0001503 ossification; GO:0001701 in utero embryonic development; GO:0001892 embryonic placenta development; GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction; GO:0008284 positive regulation of cell population proliferation; GO:0051147 regulation of muscle cell differentiation; GO:0051148 negative regulation of muscle cell differentiation; GO:0051781 positive regulation of cell division; GO:0060669 embryonic placenta morphogenesis
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  DVSASLAVLPDNFPRYPVGKFFQYDTWRQSTQRL
  • Length:  34
  • Propeptide:  MGISMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSERDVSASLAVLPDNFPRYPVGKFFQYDTWRQSTQRLRR
  • Signal peptide:  MGISMGKSMLVLLTFLAFASCCIA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3.
  • Mechanism:  The IGF2 locus is imprinted. Paternal inherited gene is expressed, while the maternal inherited gene is imprinted, hence silenced.
  • Cross BBB:  NA
  • Target:  IGF2R
  • Target Unid:  H0VN75
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q08279-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002099_AF2.pdbhor002099_ESM.pdb

Physical Information

Mass: 459227 Formula: C184H273N49O52
Absent amino acids: CEHIM Common amino acids: DFLPQRSV
pI: 9.14 Basic residues: 4
Polar residues: 9 Hydrophobic residues: 12
Hydrophobicity: -54.12 Boman Index: -7264
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 65.88
Instability Index: 2653.82 Extinction Coefficient cystines: 8480
Absorbance 280nm: 256.97

Literature

  • PubMed ID:  NA
  • Title:  Isolation of an insulin-like growth factor II cDNA from guinea pig liver: expression and developmental regulation.